(data stored in SCRATCH zone)

EMBL: CP001887.PE39

CP001887.PE39        Location/Qualifiers
FT   CDS             complement(42310..42666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17727"
FT                   /protein_id="ADH17727.1"
FT                   /translation="MESFFVLKIPFFLLNGVQDSPCLSLVLFYSFFPFTLNWFATLGGR
FT                   PTAPRNSVLIQLKLKKILSTTLVIQESPNTKKAPREYTVRGDFSKLLNFGIIEASEIRK
FT                   VPMKSALHCTLRED"
     MESFFVLKIP FFLLNGVQDS PCLSLVLFYS FFPFTLNWFA TLGGRPTAPR NSVLIQLKLK        60
     KILSTTLVIQ ESPNTKKAPR EYTVRGDFSK LLNFGIIEAS EIRKVPMKSA LHCTLRED         118
//

If you have problems or comments...

PBIL Back to PBIL home page