(data stored in SCRATCH zone)

EMBL: CP001887.PE395

CP001887.PE395       Location/Qualifiers
FT   CDS             complement(443237..443584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02005"
FT                   /product="hypothetical protein"
FT                   /note="COG1872 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18083"
FT                   /protein_id="ADH18083.1"
FT                   /translation="MRFLLKLLSKEKENILLEGFWVLEVRVTTKARENRVVCLEDGILR
FT                   VRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSIKAFLLEQFP
FT                   SESSSTTGKKS"
     MRFLLKLLSK EKENILLEGF WVLEVRVTTK ARENRVVCLE DGILRVRVTE VPEKGKANDA        60
     VVALLANFLS IPKSDVTLIA GEASRRKKVL LPRSIKAFLL EQFPSESSST TGKKS            115
//

If you have problems or comments...

PBIL Back to PBIL home page