(data stored in SCRATCH zone)

EMBL: CP001887.PE445

CP001887.PE445       Location/Qualifiers
FT   CDS             complement(504726..505778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02255"
FT                   /product="Putative oxidoreductase"
FT                   /note="COG0369 Sulfite reductase, alpha subunit
FT                   (flavoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18133"
FT                   /protein_id="ADH18133.1"
FT                   /translation="MSLFSKFKAQWMFLHSRELCSSTSDIGNTCSDPVFQVLCNPVRSE
FT                   ISYKVGDSLGVFPTNPSILVDSVLDALQYGPRSPVVSRHADSVLPLHEFLTSYVDLDKI
FT                   PKSLRPFFPGDLDDTWSLAEAILVYQPRIPFEEFIRSAMPLLPRFYSIASSPTCSHGKL
FT                   ELLVRCVSFQGKTQLRYGLCSAFLCKDLQEGESFRGFIQPTRHFTLEQKNFGKPLIMIG
FT                   AGTGIAPYKGFLQHRIYHQDVGSNILFFGERFEKSNFYYRDFLQELIVSGKLQLFTAFS
FT                   RDSESKLYVQNVIEQQKELIQEVYEQEAFFFVCGKKILGTEVKRALEQILGPKAVRELI
FT                   AQKRLVSDVY"
     MSLFSKFKAQ WMFLHSRELC SSTSDIGNTC SDPVFQVLCN PVRSEISYKV GDSLGVFPTN        60
     PSILVDSVLD ALQYGPRSPV VSRHADSVLP LHEFLTSYVD LDKIPKSLRP FFPGDLDDTW       120
     SLAEAILVYQ PRIPFEEFIR SAMPLLPRFY SIASSPTCSH GKLELLVRCV SFQGKTQLRY       180
     GLCSAFLCKD LQEGESFRGF IQPTRHFTLE QKNFGKPLIM IGAGTGIAPY KGFLQHRIYH       240
     QDVGSNILFF GERFEKSNFY YRDFLQELIV SGKLQLFTAF SRDSESKLYV QNVIEQQKEL       300
     IQEVYEQEAF FFVCGKKILG TEVKRALEQI LGPKAVRELI AQKRLVSDVY                  350
//

If you have problems or comments...

PBIL Back to PBIL home page