(data stored in SCRATCH zone)

EMBL: CP001887.PE481

CP001887.PE481       Location/Qualifiers
FT   CDS             541794..542852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02435"
FT                   /product="two component regulator, histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18169"
FT                   /protein_id="ADH18169.1"
FT                   /translation="MPKIDTCDSCVSNTELLAIRTRVTQSYNEAQTILSSIPDGIFLLS
FT                   ESGEILICNPQARAILGIPEDIQLVTRMFHDFFPDTFFGFSVQEALEKEVPPKTIRLTL
FT                   SQELSQKEVEVFVRKNISHDFLFLLIRDRSDYRQLEQAIEKYRSISELGKIAATLAHEI
FT                   RNPLTSISGFATLLKEELSSERHQRMLNVIIEGTRSLNSLVSSMLEYTKIQPLNLRSID
FT                   LQDFFSSLIPELSLTFPSCTFRRTILSPIQRSIDPDRLRCVIWNLVKNAVEASDEEIFL
FT                   ELHEKGFSVINTGTLPPNIQEKLFIPFFTTKPQGNGLGLAEAHKIMRLHGGDLVVSTQD
FT                   NRTTFTILWTPA"
     MPKIDTCDSC VSNTELLAIR TRVTQSYNEA QTILSSIPDG IFLLSESGEI LICNPQARAI        60
     LGIPEDIQLV TRMFHDFFPD TFFGFSVQEA LEKEVPPKTI RLTLSQELSQ KEVEVFVRKN       120
     ISHDFLFLLI RDRSDYRQLE QAIEKYRSIS ELGKIAATLA HEIRNPLTSI SGFATLLKEE       180
     LSSERHQRML NVIIEGTRSL NSLVSSMLEY TKIQPLNLRS IDLQDFFSSL IPELSLTFPS       240
     CTFRRTILSP IQRSIDPDRL RCVIWNLVKN AVEASDEEIF LELHEKGFSV INTGTLPPNI       300
     QEKLFIPFFT TKPQGNGLGL AEAHKIMRLH GGDLVVSTQD NRTTFTILWT PA               352
//

If you have problems or comments...

PBIL Back to PBIL home page