(data stored in SCRATCH zone)

EMBL: CP001887.PE485

CP001887.PE485       Location/Qualifiers
FT   CDS             complement(545516..546118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18173"
FT                   /protein_id="ADH18173.1"
FT                   /translation="MEKRGVIVHILVCLLTIFGTFSLPAFGAHFLAEEEQFYMDRFVFS
FT                   GQYPDMETMEIHAERKKRVQFDVTGSFPKLESVVYKGSFGLLRSKIKGECPELSSVNLS
FT                   CTSCRMDLDFRGEWKKNASIYIRNEQEPITIMLPKDIGVVVYTQVDMNSKVVAEGSLIK
FT                   RGRGFWKKTFRNSLVGESPVTLTFHVETRNGGVIFLR"
     MEKRGVIVHI LVCLLTIFGT FSLPAFGAHF LAEEEQFYMD RFVFSGQYPD METMEIHAER        60
     KKRVQFDVTG SFPKLESVVY KGSFGLLRSK IKGECPELSS VNLSCTSCRM DLDFRGEWKK       120
     NASIYIRNEQ EPITIMLPKD IGVVVYTQVD MNSKVVAEGS LIKRGRGFWK KTFRNSLVGE       180
     SPVTLTFHVE TRNGGVIFLR                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page