(data stored in SCRATCH zone)

EMBL: CP001887.PE491

CP001887.PE491       Location/Qualifiers
FT   CDS             551022..551987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02490"
FT                   /product="hypothetical protein"
FT                   /note="COG2849 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18179"
FT                   /protein_id="ADH18179.1"
FT                   /translation="MKRLFFICALALSPLAYGAVQKDPMLMKETFRNNYGIIVSKQEWN
FT                   KRGCDGSITRVFKDGTTTLEVYAQGALHGEVTRTFPHSTTLAVIETYDQGRLLSKKTFF
FT                   PNALPAKEEVYHEDGSFSLTRWPDNNNSDTITDPCFVEKTYGGRVLEGHYTSFNGKYSS
FT                   TILNGEGVRSTFSSDSILLTEESFNDGVMVKKTTFYSTREPETVTHYVNGYPHGVRFTY
FT                   LPGGIPNTIEEWRYGHQDGLTILFKNGCKIAEVPFVRGAKNGIELRYNEQENIAEEISW
FT                   QHNILHGVRKIHAAGVCKSEWYYKGKPVSQIKFERLSAAR"
     MKRLFFICAL ALSPLAYGAV QKDPMLMKET FRNNYGIIVS KQEWNKRGCD GSITRVFKDG        60
     TTTLEVYAQG ALHGEVTRTF PHSTTLAVIE TYDQGRLLSK KTFFPNALPA KEEVYHEDGS       120
     FSLTRWPDNN NSDTITDPCF VEKTYGGRVL EGHYTSFNGK YSSTILNGEG VRSTFSSDSI       180
     LLTEESFNDG VMVKKTTFYS TREPETVTHY VNGYPHGVRF TYLPGGIPNT IEEWRYGHQD       240
     GLTILFKNGC KIAEVPFVRG AKNGIELRYN EQENIAEEIS WQHNILHGVR KIHAAGVCKS       300
     EWYYKGKPVS QIKFERLSAA R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page