(data stored in SCRATCH zone)

EMBL: CP001887.PE494

CP001887.PE494       Location/Qualifiers
FT   CDS             complement(554253..555731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02505"
FT                   /product="hypothetical protein"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18182"
FT                   /protein_id="ADH18182.1"
FT                   /translation="MLRYILKRLLLIPLTLFAIISVNFVILNAAPGDLLEEHSVDAQGE
FT                   AGRSDKVRTYKGPDRYLQFREHYGLTLPIFFNTRPQISRSELRAGIQEIIDGTIHKKSK
FT                   TGSITNIKVYWGDCAKFIMPALLAEAEDSSKEDIYRHVAADLFIRGGIRQGIVGARLLE
FT                   EQREYNQKVSKSNAELVRLLNEDNIEVKVAALQEWVEQEGGRGQLMRRDLWRIFFLETR
FT                   FAKYLSRIVRLDFGTLRNDCHKTVVSEVIKRLGSSLILSLLPMIVVFILCQVFGMIMAV
FT                   NKNHWIDHLLNFLFLILFSIPVFVAVPWIIDNFVLNKTVPFTSISMPYSGLCSSPEIFK
FT                   EMTSFEKLTDIVLHSFLPFCAVSYGAFAAQSRLSRAVFLEVLGEDHISALRARGISQYD
FT                   ILVRHVGKNSAATLITSLASSLSALLGGALVVETLFDIDGFGKFFYQAILNRDHNVVMF
FT                   SVIMGSVISLIGYLIGDICYVLLDPRVQLEERKV"
     MLRYILKRLL LIPLTLFAII SVNFVILNAA PGDLLEEHSV DAQGEAGRSD KVRTYKGPDR        60
     YLQFREHYGL TLPIFFNTRP QISRSELRAG IQEIIDGTIH KKSKTGSITN IKVYWGDCAK       120
     FIMPALLAEA EDSSKEDIYR HVAADLFIRG GIRQGIVGAR LLEEQREYNQ KVSKSNAELV       180
     RLLNEDNIEV KVAALQEWVE QEGGRGQLMR RDLWRIFFLE TRFAKYLSRI VRLDFGTLRN       240
     DCHKTVVSEV IKRLGSSLIL SLLPMIVVFI LCQVFGMIMA VNKNHWIDHL LNFLFLILFS       300
     IPVFVAVPWI IDNFVLNKTV PFTSISMPYS GLCSSPEIFK EMTSFEKLTD IVLHSFLPFC       360
     AVSYGAFAAQ SRLSRAVFLE VLGEDHISAL RARGISQYDI LVRHVGKNSA ATLITSLASS       420
     LSALLGGALV VETLFDIDGF GKFFYQAILN RDHNVVMFSV IMGSVISLIG YLIGDICYVL       480
     LDPRVQLEER KV                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page