(data stored in SCRATCH zone)

EMBL: CP001887.PE503

CP001887.PE503       Location/Qualifiers
FT   CDS             complement(562889..563674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02550"
FT                   /product="glutamine-binding protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18191"
FT                   /protein_id="ADH18191.1"
FT                   /translation="MIRGSSLISEVRVKFKYLRPLSFLVLVIVAFCYGCSREKQEILVG
FT                   RDATWFPQQFGIYTSGINAFVNDLVSEINYKEGLNISIVNQDWVHLFENLDDKKTSGAF
FT                   TSASPSIEMLARYQFSDPVLLTGPVLVVLENSPYHSLQDLEGKLIGVYKFDSSVLIAQN
FT                   VPNAVIDSYQHIPVALEALSTQRYDALLVPVIEATALVETAYKGRLRIASEPLNEEGLR
FT                   LVVLRGGGSDSLLEGFNAGLAKIRRSGRYKAIKMQSRLP"
     MIRGSSLISE VRVKFKYLRP LSFLVLVIVA FCYGCSREKQ EILVGRDATW FPQQFGIYTS        60
     GINAFVNDLV SEINYKEGLN ISIVNQDWVH LFENLDDKKT SGAFTSASPS IEMLARYQFS       120
     DPVLLTGPVL VVLENSPYHS LQDLEGKLIG VYKFDSSVLI AQNVPNAVID SYQHIPVALE       180
     ALSTQRYDAL LVPVIEATAL VETAYKGRLR IASEPLNEEG LRLVVLRGGG SDSLLEGFNA       240
     GLAKIRRSGR YKAIKMQSRL P                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page