(data stored in SCRATCH zone)

EMBL: CP001887.PE515

CP001887.PE515       Location/Qualifiers
FT   CDS             complement(575371..575520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18203"
FT                   /protein_id="ADH18203.1"
FT                   /translation="MGWGFFVWVAIVRGLFLWLVKEALSARLGYRGIYPQEERGGEEKY
FT                   RFLG"
     MGWGFFVWVA IVRGLFLWLV KEALSARLGY RGIYPQEERG GEEKYRFLG                    49
//

If you have problems or comments...

PBIL Back to PBIL home page