(data stored in SCRATCH zone)

EMBL: CP001887.PE526

CP001887.PE526       Location/Qualifiers
FT   CDS             complement(584809..585942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02665"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18214"
FT                   /protein_id="ADH18214.1"
FT                   /translation="MSDSSHNLLYNKFELPESVKMSPVEGAVGGIDKVARFVADPLEKG
FT                   MGHTLGSALRRALLIGLEAPAIVSFSMTGVLHEYMAVEGIIEDVTNIVLNLKGSLLKKY
FT                   PLQDCEGGRCSQKLRATISIDASDLAAAGGQKEVTLGDLLQEGTFEAVNPEHVIFTVTR
FT                   PMQLEVMLRVAFGRGYSPSERIVLEERGMNEIVLDAAFSPVVLVNYFVEDTRVGQDTDF
FT                   DRLVLQVETDGRVAPKEAVAFATQILSKHFSVFEKMDEKRIVFEEAISVEKENKDDILH
FT                   KLVLGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEM
FT                   KLELGMDLSQFGVGLDNVKEKMKWYAEKIRSSKNTKG"
     MSDSSHNLLY NKFELPESVK MSPVEGAVGG IDKVARFVAD PLEKGMGHTL GSALRRALLI        60
     GLEAPAIVSF SMTGVLHEYM AVEGIIEDVT NIVLNLKGSL LKKYPLQDCE GGRCSQKLRA       120
     TISIDASDLA AAGGQKEVTL GDLLQEGTFE AVNPEHVIFT VTRPMQLEVM LRVAFGRGYS       180
     PSERIVLEER GMNEIVLDAA FSPVVLVNYF VEDTRVGQDT DFDRLVLQVE TDGRVAPKEA       240
     VAFATQILSK HFSVFEKMDE KRIVFEEAIS VEKENKDDIL HKLVLGINEI ELSVRSTNCL       300
     SNANIETIGE LVIMPEPRLL QFRNFGKKSL CEIKNKLKEM KLELGMDLSQ FGVGLDNVKE       360
     KMKWYAEKIR SSKNTKG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page