(data stored in SCRATCH zone)

EMBL: CP001887.PE61

CP001887.PE61        Location/Qualifiers
FT   CDS             complement(67493..68596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17749"
FT                   /protein_id="ADH17749.1"
FT                   /translation="MFTSLSAIQNAIRPSCRLPVLTPRRTLITSLASGIILGLAGCVVG
FT                   VLASFPALIAVSAVILGVSLFALGLFLCRYVCPPKIVSRRPSTELPAEPTPELPEIKRP
FT                   KPIAPPPPDFIPPRPLRRTIGEMLFGWNCIGSIRQMPFFLANDKTPLSFRNPSARFRAW
FT                   NIPSTHTIFVSTSGQFSSLRMQSNLPAAIANATQSAAFAKRGQGGLGVNDAFPAVLTDK
FT                   CWEESKPDSGILLPGECSSATWEDKNHLVPCWDEETKTYNKPLLFIQMLAPKASMYQDD
FT                   SKSCYEITLQAYTACFEEAIRCGCRMIQIPLIAAFGDFVPRALSKRPKWIESAKLSLLH
FT                   AVEKTAKKHASKDLVIVLTNIPQPVNL"
     MFTSLSAIQN AIRPSCRLPV LTPRRTLITS LASGIILGLA GCVVGVLASF PALIAVSAVI        60
     LGVSLFALGL FLCRYVCPPK IVSRRPSTEL PAEPTPELPE IKRPKPIAPP PPDFIPPRPL       120
     RRTIGEMLFG WNCIGSIRQM PFFLANDKTP LSFRNPSARF RAWNIPSTHT IFVSTSGQFS       180
     SLRMQSNLPA AIANATQSAA FAKRGQGGLG VNDAFPAVLT DKCWEESKPD SGILLPGECS       240
     SATWEDKNHL VPCWDEETKT YNKPLLFIQM LAPKASMYQD DSKSCYEITL QAYTACFEEA       300
     IRCGCRMIQI PLIAAFGDFV PRALSKRPKW IESAKLSLLH AVEKTAKKHA SKDLVIVLTN       360
     IPQPVNL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page