(data stored in SCRATCH zone)

EMBL: CP001887.PE613

CP001887.PE613       Location/Qualifiers
FT   CDS             complement(673027..673545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03110"
FT                   /product="succinate dehydrogenase cytochrome b558 subunit"
FT                   /note="COG2009 Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18301"
FT                   /protein_id="ADH18301.1"
FT                   /translation="MTAWILLAGLAFHVIQFRFVLYPIQVTIQGKTFYAVSFDAARYPS
FT                   VVQGITGFFIMNVPFAEGGPQITEQFLQEKDRALFASHKSYIFTPEAGKAFLYAVRNAL
FT                   GSLWMAIFYTLFVIAAVFHGFNGVWTFVSRWGIIISSRYLRLCQILCYVGMCVVMAMGI
FT                   SVIWNMYLL"
     MTAWILLAGL AFHVIQFRFV LYPIQVTIQG KTFYAVSFDA ARYPSVVQGI TGFFIMNVPF        60
     AEGGPQITEQ FLQEKDRALF ASHKSYIFTP EAGKAFLYAV RNALGSLWMA IFYTLFVIAA       120
     VFHGFNGVWT FVSRWGIIIS SRYLRLCQIL CYVGMCVVMA MGISVIWNMY LL               172
//

If you have problems or comments...

PBIL Back to PBIL home page