(data stored in SCRATCH zone)

EMBL: CP001887.PE618

CP001887.PE618       Location/Qualifiers
FT   CDS             677837..678244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03135"
FT                   /product="macromolecule transport protein"
FT                   /note="COG0848 Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18306"
FT                   /protein_id="ADH18306.1"
FT                   /translation="MKRFVYEDLEEDPSVSLTPLIDIVFVILMAFMIAMPLIKIDRISL
FT                   ATGSSSHQAFKKQESQQAEIKVFRNHTITLNDLPMSLQELRSQLTVIHAQHPNIVPLLL
FT                   QDGDTAFKLYQEIKSTIEEAGFQELHVALKN"
     MKRFVYEDLE EDPSVSLTPL IDIVFVILMA FMIAMPLIKI DRISLATGSS SHQAFKKQES        60
     QQAEIKVFRN HTITLNDLPM SLQELRSQLT VIHAQHPNIV PLLLQDGDTA FKLYQEIKST       120
     IEEAGFQELH VALKN                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page