(data stored in SCRATCH zone)

EMBL: CP001887.PE669

CP001887.PE669       Location/Qualifiers
FT   CDS             complement(741196..741492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03390"
FT                   /product="integral membrane protein"
FT                   /note="COG0762 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18357"
FT                   /protein_id="ADH18357.1"
FT                   /translation="MLSYLLRTAVNIYSFLILVYVLCSWLPECHNTQWYRIIRRWVSPY
FT                   LRIFHKFVPRIGFIDISPMIALLCLGVLPFMILKILRFIVLNIFQSPWLLQYL"
     MLSYLLRTAV NIYSFLILVY VLCSWLPECH NTQWYRIIRR WVSPYLRIFH KFVPRIGFID        60
     ISPMIALLCL GVLPFMILKI LRFIVLNIFQ SPWLLQYL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page