(data stored in SCRATCH zone)

EMBL: CP001887.PE695

CP001887.PE695       Location/Qualifiers
FT   CDS             764665..765336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18383"
FT                   /protein_id="ADH18383.1"
FT                   /translation="MIDPLKLFPNFDGDKESAAVNKPSASPMPSELSKNVASFSLGGGG
FT                   AALDSTVSTEKLSLMAMMQDKNSQLIDPELEEALNSEELQEQIHLLKSRLWDAQTQMQM
FT                   QDPDKLASEHVDALGVIVDLINGDFQAIAEHTQQTVKQGNGDEEKSVTRKIVDWVSSGE
FT                   EILNRALLYFSDRNGERETLADFLKVQYAVQRATQRAELFASILGATVSSVKTIMTTQL
FT                   G"
     MIDPLKLFPN FDGDKESAAV NKPSASPMPS ELSKNVASFS LGGGGAALDS TVSTEKLSLM        60
     AMMQDKNSQL IDPELEEALN SEELQEQIHL LKSRLWDAQT QMQMQDPDKL ASEHVDALGV       120
     IVDLINGDFQ AIAEHTQQTV KQGNGDEEKS VTRKIVDWVS SGEEILNRAL LYFSDRNGER       180
     ETLADFLKVQ YAVQRATQRA ELFASILGAT VSSVKTIMTT QLG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page