(data stored in SCRATCH zone)

EMBL: CP001887.PE713

CP001887.PE713       Location/Qualifiers
FT   CDS             complement(785479..785619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18401"
FT                   /protein_id="ADH18401.1"
FT                   /translation="MILLFHQDATLFGVELVRKEPIISSVSKKAKQILNCNSRYFFRTP
FT                   S"
     MILLFHQDAT LFGVELVRKE PIISSVSKKA KQILNCNSRY FFRTPS                       46
//

If you have problems or comments...

PBIL Back to PBIL home page