(data stored in SCRATCH zone)

EMBL: CP001887.PE714

CP001887.PE714       Location/Qualifiers
FT   CDS             785618..787069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03625"
FT                   /product="cysteine desulfurase activator complex subunit
FT                   SufB"
FT                   /note="COG0719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03625"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18402"
FT                   /protein_id="ADH18402.1"
FT                   /translation="MDAPVDKFLQQQEYPYGFVTPIQSEGLAPGISQEHIEQLVHLRGE
FT                   PKFLLDFRLKAFRFWQKMEEPTWARLRYPPIAYDDIVYFSAPKTKKPLGKLEDADPEIL
FT                   ETFKKLGIPIDEQKRLLNVQDVAMDLVFDSVSIGTTFKKTLEDAGVIFCSFREAIHNYP
FT                   DLVKRYLGSVVPARDNFFAALNSAVFSDGSFVYIPKGVCCPMEISTYFRINDKESGQFE
FT                   RTLIIAEDDSYVSYLEGCTAPSFSSHQLHAAVVELVAHNRSVIRYSTVQNWYPGDRKTG
FT                   KGGIYNFVTKRGLCAGEHSKISWSQVEVGAAITWKYPSCILKGENSVGEFYSIALTNGK
FT                   MQADTGTKMLHIGKGSSSTIVSKGISAEESHNTFRSLVSISSQAVGSCNYTQCDSMLVG
FT                   EHCGAYTDPQIVVNNGESCVEHEAATSKLREDQLFYLRSRGFNTEEAVSLVVHGFCREV
FT                   IELLPLEFAREATKLLMIKLENSVG"
     MDAPVDKFLQ QQEYPYGFVT PIQSEGLAPG ISQEHIEQLV HLRGEPKFLL DFRLKAFRFW        60
     QKMEEPTWAR LRYPPIAYDD IVYFSAPKTK KPLGKLEDAD PEILETFKKL GIPIDEQKRL       120
     LNVQDVAMDL VFDSVSIGTT FKKTLEDAGV IFCSFREAIH NYPDLVKRYL GSVVPARDNF       180
     FAALNSAVFS DGSFVYIPKG VCCPMEISTY FRINDKESGQ FERTLIIAED DSYVSYLEGC       240
     TAPSFSSHQL HAAVVELVAH NRSVIRYSTV QNWYPGDRKT GKGGIYNFVT KRGLCAGEHS       300
     KISWSQVEVG AAITWKYPSC ILKGENSVGE FYSIALTNGK MQADTGTKML HIGKGSSSTI       360
     VSKGISAEES HNTFRSLVSI SSQAVGSCNY TQCDSMLVGE HCGAYTDPQI VVNNGESCVE       420
     HEAATSKLRE DQLFYLRSRG FNTEEAVSLV VHGFCREVIE LLPLEFAREA TKLLMIKLEN       480
     SVG                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page