(data stored in SCRATCH zone)

EMBL: CP001887.PE724

CP001887.PE724       Location/Qualifiers
FT   CDS             796706..797677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03675"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18412"
FT                   /protein_id="ADH18412.1"
FT                   /translation="MSIRPTNGSGNGYSSINPSNDNQDGLVQSTSGPNYEGHTVSSRGG
FT                   FQGICARIANLFRNCFSRNRGTTTTPSRPVITQANIHHPTISGQGAQPIVSTGDKKLDS
FT                   AIIQADLRAQNKQTLATHIQSKLGSMEGQSPQDYKAGAYSALRLMLFTPGETTVSSERE
FT                   RQACVTGRDLWEQAAGDLATNGNTDGLMLMANLSVGGKHVPAGHLREYMDTVKGTFTDE
FT                   NKATDPTVDAILDLAAKIDATEFSSPGSGKVILNYIGNCGQVVLENEEMNQLILGDQNG
FT                   QDPQHVQDNSKELQKLLENARKTDPELYFQTLTVITSSVFLD"
     MSIRPTNGSG NGYSSINPSN DNQDGLVQST SGPNYEGHTV SSRGGFQGIC ARIANLFRNC        60
     FSRNRGTTTT PSRPVITQAN IHHPTISGQG AQPIVSTGDK KLDSAIIQAD LRAQNKQTLA       120
     THIQSKLGSM EGQSPQDYKA GAYSALRLML FTPGETTVSS ERERQACVTG RDLWEQAAGD       180
     LATNGNTDGL MLMANLSVGG KHVPAGHLRE YMDTVKGTFT DENKATDPTV DAILDLAAKI       240
     DATEFSSPGS GKVILNYIGN CGQVVLENEE MNQLILGDQN GQDPQHVQDN SKELQKLLEN       300
     ARKTDPELYF QTLTVITSSV FLD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page