(data stored in SCRATCH zone)

EMBL: CP001887.PE747

CP001887.PE747       Location/Qualifiers
FT   CDS             complement(828724..829089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18435"
FT                   /protein_id="ADH18435.1"
FT                   /translation="MNKKLQDLSKLLTIELFKKRTRLETVKKALSTIEHRLQQIQEHIA
FT                   KISLTRHKQFLCRSYTHEYDQHLEHLQREQTSLYKQHQTLKTSLKDAYGDIQKQLDQRK
FT                   IIEKIHDSKYPIKSANN"
     MNKKLQDLSK LLTIELFKKR TRLETVKKAL STIEHRLQQI QEHIAKISLT RHKQFLCRSY        60
     THEYDQHLEH LQREQTSLYK QHQTLKTSLK DAYGDIQKQL DQRKIIEKIH DSKYPIKSAN       120
     N                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page