(data stored in SCRATCH zone)

EMBL: CP001887.PE77

CP001887.PE77        Location/Qualifiers
FT   CDS             complement(87017..87994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00385"
FT                   /product="exported protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17765"
FT                   /protein_id="ADH17765.1"
FT                   /translation="MKNFLLTILFLLMGTSLLADPSVIQTLTSGVAGVNSIREEKESVV
FT                   CVHAFLRSYGSLKPIGRVLEKENYDVFIWNYETRKFTLEKHAEHLVRLLNKIAELKPGI
FT                   PINFVTHSVGGVIVRVALAHPDCPEEAKKGKAVLMAPPNAGSTLARRYSRSSLVQFVFG
FT                   RKLGMQLLTYSPEHMLNVAKMPSSVDVLVLSGTKKSKFLLFQLEEDNDGKVCVTETRLD
FT                   TPHQNYIIDANHTYIITNKTSLFLMREFLRNGSRSSALTQVPEEIEASIQQSPKADVNK
FT                   EKSKDIYVIHCLGAHPYSLYGFPKSRTSPNENSRKVLEGQEYKK"
     MKNFLLTILF LLMGTSLLAD PSVIQTLTSG VAGVNSIREE KESVVCVHAF LRSYGSLKPI        60
     GRVLEKENYD VFIWNYETRK FTLEKHAEHL VRLLNKIAEL KPGIPINFVT HSVGGVIVRV       120
     ALAHPDCPEE AKKGKAVLMA PPNAGSTLAR RYSRSSLVQF VFGRKLGMQL LTYSPEHMLN       180
     VAKMPSSVDV LVLSGTKKSK FLLFQLEEDN DGKVCVTETR LDTPHQNYII DANHTYIITN       240
     KTSLFLMREF LRNGSRSSAL TQVPEEIEAS IQQSPKADVN KEKSKDIYVI HCLGAHPYSL       300
     YGFPKSRTSP NENSRKVLEG QEYKK                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page