(data stored in SCRATCH zone)

EMBL: CP001887.RECO

CP001887.RECO        Location/Qualifiers
FT   CDS             544788..545519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="G9768_02450"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18172"
FT                   /protein_id="ADH18172.1"
FT                   /translation="MQITLPGVVLTNSPAEKQYVIVKIFSPAGLLSAFAKNGASLSCDF
FT                   RESLFPISFSLFTIQQSPPKMRKVIQGELQNPFTTIKSSYPLLQSAGKMIQAILKTQWH
FT                   EKPSPHLFSLFLNFLQRIPETQYPNFFSSMFLLKLLQHEGSLDLSRSCTLCKTPLESST
FT                   IYRYEGALFCEKHAHEETISFSQEEDHILRVIVQAKKFQELVCLAEFPIDIDTKIDALF
FT                   SSFLSETSEPSSLYYKGKTLL"
     MQITLPGVVL TNSPAEKQYV IVKIFSPAGL LSAFAKNGAS LSCDFRESLF PISFSLFTIQ        60
     QSPPKMRKVI QGELQNPFTT IKSSYPLLQS AGKMIQAILK TQWHEKPSPH LFSLFLNFLQ       120
     RIPETQYPNF FSSMFLLKLL QHEGSLDLSR SCTLCKTPLE SSTIYRYEGA LFCEKHAHEE       180
     TISFSQEEDH ILRVIVQAKK FQELVCLAEF PIDIDTKIDA LFSSFLSETS EPSSLYYKGK       240
     TLL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page