(data stored in SCRATCH zone)

EMBL: CP001887.RPLF

CP001887.RPLF        Location/Qualifiers
FT   CDS             complement(589535..590086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="G9768_02700"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18221"
FT                   /protein_id="ADH18221.1"
FT                   /translation="MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAV
FT                   KGNEVFVTPAAHVVDRPGRIQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLL
FT                   DLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGI
FT                   RYENEYVRRKAGKAAKTGKK"
     MSRKARDPIV LPQGVEVSIQ NDEISVKGPK GSLTQVLAKE VEIAVKGNEV FVTPAAHVVD        60
     RPGRIQGLYW ALIANMVKGV HTGFEKRLEM IGVGFRAAVQ GSLLDLSIGV SHPTKMPIPT       120
     GLEVSVEKNT LISIKGINKQ LVGEFAACVR AKRPPEPYKG KGIRYENEYV RRKAGKAAKT       180
     GKK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page