(data stored in SCRATCH zone)

EMBL: CP001887.RPLK

CP001887.RPLK        Location/Qualifiers
FT   CDS             complement(361008..361433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="G9768_01630"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18009"
FT                   /protein_id="ADH18009.1"
FT                   /translation="MSNKKIIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNA
FT                   ATQDRPGDLLPVVITVYSDKTFSFVMKQSPVSSLIKKALGLESGSKIPNRNKVGKLTRA
FT                   QITVIAEQKMKDMDVVLLESAERMVEGAARSMGVDVE"
     MSNKKIIKII KLQIPGGKAN PAPPIGPALG AAGVNIMGFC KEFNAATQDR PGDLLPVVIT        60
     VYSDKTFSFV MKQSPVSSLI KKALGLESGS KIPNRNKVGK LTRAQITVIA EQKMKDMDVV       120
     LLESAERMVE GAARSMGVDV E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page