(data stored in SCRATCH zone)

EMBL: CP001887.RPLL

CP001887.RPLL        Location/Qualifiers
FT   CDS             complement(359323..359715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="G9768_01615"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18006"
FT                   /protein_id="ADH18006.1"
FT                   /translation="MTTESLETLVEQLSGLTVLELSQLKKLLEEKWDVTAAAPVVAVAG
FT                   AAAAGDAPASAEPTEFAVILEDVPSDKKIGVLKVVREVTGLALKEAKEMTEGLPKTVKE
FT                   KTSKSDAEDTVKKLQEAGAKAVAKGL"
     MTTESLETLV EQLSGLTVLE LSQLKKLLEE KWDVTAAAPV VAVAGAAAAG DAPASAEPTE        60
     FAVILEDVPS DKKIGVLKVV REVTGLALKE AKEMTEGLPK TVKEKTSKSD AEDTVKKLQE       120
     AGAKAVAKGL                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page