(data stored in SCRATCH zone)

EMBL: CP001887.RPLM

CP001887.RPLM        Location/Qualifiers
FT   CDS             141562..142014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="G9768_00645"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17815"
FT                   /protein_id="ADH17815.1"
FT                   /translation="MEKRKDTKTTLAKASDDRNKAWYVVNAEGKTLGRLSSEVAKILRG
FT                   KHKVTFTPHVAMGDGVIVINAEKVRLTGAKRAQKVYHYYTGFISGMREVPFENMIARKP
FT                   AYVIEHAVKGMLPKTKLGRRQMKSLRVLKGSSYAQYEAIKPIVLDA"
     MEKRKDTKTT LAKASDDRNK AWYVVNAEGK TLGRLSSEVA KILRGKHKVT FTPHVAMGDG        60
     VIVINAEKVR LTGAKRAQKV YHYYTGFISG MREVPFENMI ARKPAYVIEH AVKGMLPKTK       120
     LGRRQMKSLR VLKGSSYAQY EAIKPIVLDA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page