(data stored in SCRATCH zone)

EMBL: CP001887.RPSB

CP001887.RPSB        Location/Qualifiers
FT   CDS             complement(777946..778794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="G9768_03590"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18396"
FT                   /protein_id="ADH18396.1"
FT                   /translation="MEFSCTLTLKELLESGAHFGHQTSRWNPRMKPFIFEEKNGLYIID
FT                   LAKTLAQLKKAVACIQTTIGQEKSILFVGTKKQAKQIIREAAIECGEFFASERWLGGML
FT                   TNMATIRNSVKTLNRIELDLEASNSGLTKKELALLAKRHRKLLNNLEGVRHMNSLPGLL
FT                   IVIDPGYERIAVAEAGKLGIPVMALVDTNCDPTPINHVIPCNDDSMKSIRLIVNVLKDA
FT                   VIDAKKRLGVEILSPVRPAERPAEEAVEELPLPTGEAQDEASSKEGVLLWADIDNCEAL
FT                   K"
     MEFSCTLTLK ELLESGAHFG HQTSRWNPRM KPFIFEEKNG LYIIDLAKTL AQLKKAVACI        60
     QTTIGQEKSI LFVGTKKQAK QIIREAAIEC GEFFASERWL GGMLTNMATI RNSVKTLNRI       120
     ELDLEASNSG LTKKELALLA KRHRKLLNNL EGVRHMNSLP GLLIVIDPGY ERIAVAEAGK       180
     LGIPVMALVD TNCDPTPINH VIPCNDDSMK SIRLIVNVLK DAVIDAKKRL GVEILSPVRP       240
     AERPAEEAVE ELPLPTGEAQ DEASSKEGVL LWADIDNCEA LK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page