(data stored in SCRATCH zone)

EMBL: CP001887.RPSC

CP001887.RPSC        Location/Qualifiers
FT   CDS             complement(592723..593397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="G9768_02740"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18229"
FT                   /protein_id="ADH18229.1"
FT                   /translation="MGQKGCPIGFRTAVTKKWRSLWYGNNQEFGKFLIEDVKIREFLKK
FT                   KPSCQGAAGFVVKRMSGKIEVTIHTARPGLVIGKKGAEVESLKAELKKLTGKDVWVEIA
FT                   EVKRPELNAQLVADGIAKQIERRVSFRRAMKKALQSVMDAGALGVKVQVSGRLAGAEIA
FT                   RSEWYKNGRVPLHTLRADIDYATASAETTYGIIGIKVWINLGEKKAVPAANHAGAASTA
FT                   AA"
     MGQKGCPIGF RTAVTKKWRS LWYGNNQEFG KFLIEDVKIR EFLKKKPSCQ GAAGFVVKRM        60
     SGKIEVTIHT ARPGLVIGKK GAEVESLKAE LKKLTGKDVW VEIAEVKRPE LNAQLVADGI       120
     AKQIERRVSF RRAMKKALQS VMDAGALGVK VQVSGRLAGA EIARSEWYKN GRVPLHTLRA       180
     DIDYATASAE TTYGIIGIKV WINLGEKKAV PAANHAGAAS TAAA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page