(data stored in SCRATCH zone)

EMBL: CP001887.RPSI

CP001887.RPSI        Location/Qualifiers
FT   CDS             142040..142429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="G9768_00650"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17816"
FT                   /protein_id="ADH17816.1"
FT                   /translation="MIQESVATGRRKQAVSSVRLRSGNGKIDVNGKTLEQYFPLEVQRA
FT                   TILAPLRMLGDVNSFDLIIRVSGGGVQGQVIATRLGLARAVLQEKEDMKQELKAQGFLT
FT                   RDPRKKERKKYGRKKARKSFQFSKR"
     MIQESVATGR RKQAVSSVRL RSGNGKIDVN GKTLEQYFPL EVQRATILAP LRMLGDVNSF        60
     DLIIRVSGGG VQGQVIATRL GLARAVLQEK EDMKQELKAQ GFLTRDPRKK ERKKYGRKKA       120
     RKSFQFSKR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page