(data stored in ACNUC7421 zone)

EMBL: CP001958.PE100

CP001958.PE100       Location/Qualifiers
FT   CDS             complement(78775..79467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mab:MAB_2802c ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96593"
FT                   /db_xref="GOA:D6Z9R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG96593.1"
FT                   /translation="MIDHLVRWFGADPSWNRLGPQLGEAFGDTLWMVLVTIVFGGVLGL
FT                   ILGVVLYCSRPSGLLENRLAHIVLNVAVNVVRPIPFVLLVAALGPITLGLIHTTIGVQA
FT                   AVFVMVVSAAFAIARIVEQNLVTIDPGVIEAARAVGAGPLRIIVTLLIPEALGPLILGY
FT                   TFVLVGVVDMSAMAGVVGGGGIGDFAITYGYNRFRWDVTLVSVLIIIVFVQLAQFLGNY
FT                   LARKALRR"
     MIDHLVRWFG ADPSWNRLGP QLGEAFGDTL WMVLVTIVFG GVLGLILGVV LYCSRPSGLL        60
     ENRLAHIVLN VAVNVVRPIP FVLLVAALGP ITLGLIHTTI GVQAAVFVMV VSAAFAIARI       120
     VEQNLVTIDP GVIEAARAVG AGPLRIIVTL LIPEALGPLI LGYTFVLVGV VDMSAMAGVV       180
     GGGGIGDFAI TYGYNRFRWD VTLVSVLIII VFVQLAQFLG NYLARKALRR                  230
//

If you have problems or comments...

PBIL Back to PBIL home page