(data stored in ACNUC7421 zone)

EMBL: CP001958.PE101

CP001958.PE101       Location/Qualifiers
FT   CDS             complement(79464..80519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0103"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mab:MAB_2803c methionine import ATP-binding
FT                   protein MetN; PFAM: ABC transporter related; NIL domain;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96594"
FT                   /db_xref="GOA:D6Z9R7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96594.1"
FT                   /translation="MTQNTAASGGTSIRFENVSKTFASGKRLVTAVDNVSLDIPSGEIF
FT                   AMIGYSGAGKSTLLRMINGLERPTSGRVLVGGAEVSSLPERQLRAIRADVGMVFQQFNL
FT                   FRSRTVAGNVAYPLKVAGWPAAKRAARVAELLDFVGLADKAKHYPDQLSGGQKQRVGVA
FT                   RALASGPSVLLADEATSALDPETTKDVLGLLRSVNTEFGVTIVAITHSMSVVRALADRV
FT                   AVLANGAVVETGTVFDIFANPRSDISRNFVSTVLRHAPDSQDLARIARRHAGTIVSVEI
FT                   RDDVQIGRLLSEAARGGVGFEVVHGGVSSLQSRVFGNLSLELQGPPEGVARLVGELKAA
FT                   TKTIVAQEALP"
     MTQNTAASGG TSIRFENVSK TFASGKRLVT AVDNVSLDIP SGEIFAMIGY SGAGKSTLLR        60
     MINGLERPTS GRVLVGGAEV SSLPERQLRA IRADVGMVFQ QFNLFRSRTV AGNVAYPLKV       120
     AGWPAAKRAA RVAELLDFVG LADKAKHYPD QLSGGQKQRV GVARALASGP SVLLADEATS       180
     ALDPETTKDV LGLLRSVNTE FGVTIVAITH SMSVVRALAD RVAVLANGAV VETGTVFDIF       240
     ANPRSDISRN FVSTVLRHAP DSQDLARIAR RHAGTIVSVE IRDDVQIGRL LSEAARGGVG       300
     FEVVHGGVSS LQSRVFGNLS LELQGPPEGV ARLVGELKAA TKTIVAQEAL P                351
//

If you have problems or comments...

PBIL Back to PBIL home page