(data stored in ACNUC7421 zone)

EMBL: CP001958.PE103

CP001958.PE103       Location/Qualifiers
FT   CDS             complement(81614..82519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0105"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: mab:MAB_2804c ABC
FT                   transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96596"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R9"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADG96596.1"
FT                   /translation="MRVRTAARFGIVPAALALLAGALGACGSPEPTATVKIGTTDDKGE
FT                   GWKAFVQEAKRQGINLETTPSWDYLGPNDELENKQVDVNLAQHLRSLARYNVEHGTQLA
FT                   PIASTYIVPLGLYSKKHRTLAEIPQGAKIAIPDYPPDTARALFVLRSAGLVVLKGDPWS
FT                   PTKDDVDPSSKVAVETIKADFLVRGYTEDDGAVVNNTWLASAGIDPSAALAKDDPSAIN
FT                   SPDPQERARMEQYINVIVARSEDKNNPLYKRLGDIYHAKPVQDTYARQSKGSQIDVKKT
FT                   PEELQSALVALESRIRADRK"
     MRVRTAARFG IVPAALALLA GALGACGSPE PTATVKIGTT DDKGEGWKAF VQEAKRQGIN        60
     LETTPSWDYL GPNDELENKQ VDVNLAQHLR SLARYNVEHG TQLAPIASTY IVPLGLYSKK       120
     HRTLAEIPQG AKIAIPDYPP DTARALFVLR SAGLVVLKGD PWSPTKDDVD PSSKVAVETI       180
     KADFLVRGYT EDDGAVVNNT WLASAGIDPS AALAKDDPSA INSPDPQERA RMEQYINVIV       240
     ARSEDKNNPL YKRLGDIYHA KPVQDTYARQ SKGSQIDVKK TPEELQSALV ALESRIRADR       300
     K                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page