(data stored in ACNUC7421 zone)

EMBL: CP001958.PE104

CP001958.PE104       Location/Qualifiers
FT   CDS             82604..83548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0106"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="KEGG: npu:Npun_R6310 DNA-cytosine methyltransferase;
FT                   TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96597"
FT                   /db_xref="GOA:D6Z9S0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S0"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADG96597.1"
FT                   /translation="MAPHDIVGRPRLLDLFAGCGGLSLGFESAGFEVALAVDNWPEALA
FT                   VYRRNFRHRAVELDLGDVDLASSALRECAAEVDGIIGGPPCQDFSSAGRRVEAGRADLT
FT                   EKFAQLVATFLPSFFVMENVERAAKAAAPRRAVALLEAHGYCVARIVLDASRCGVPQRR
FT                   KRLFTIGFLHPGSTRAAMGALTGNLAAAPMTLRDYFGSALDVDHYYRHPRSYARRAVFS
FT                   VDEPSPTVRGVNRPVPRGYPGHPGDTAPLTAGLRALTTAERAMVQTFPPDFWFGATKTA
FT                   AEQMIGNAVPVKLAQYVAEAVRQGLASAQRACA"
     MAPHDIVGRP RLLDLFAGCG GLSLGFESAG FEVALAVDNW PEALAVYRRN FRHRAVELDL        60
     GDVDLASSAL RECAAEVDGI IGGPPCQDFS SAGRRVEAGR ADLTEKFAQL VATFLPSFFV       120
     MENVERAAKA AAPRRAVALL EAHGYCVARI VLDASRCGVP QRRKRLFTIG FLHPGSTRAA       180
     MGALTGNLAA APMTLRDYFG SALDVDHYYR HPRSYARRAV FSVDEPSPTV RGVNRPVPRG       240
     YPGHPGDTAP LTAGLRALTT AERAMVQTFP PDFWFGATKT AAEQMIGNAV PVKLAQYVAE       300
     AVRQGLASAQ RACA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page