(data stored in ACNUC7421 zone)

EMBL: CP001958.PE106

CP001958.PE106       Location/Qualifiers
FT   CDS             84304..86325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0108"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nfa:nfa60 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96599"
FT                   /db_xref="GOA:D6Z9S2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG96599.1"
FT                   /translation="MSEKKNADKSSYGASSITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VQEVVDNSVDEAMAGYATRVDVTLLADGGVEVVDDGRGIPVAPHASGPPTVEVVLTVLH
FT                   AGGKFDSDSYAVSGGLHGVGISVVNALSYKLEVEIDVDGFHWSQSYDKAKPGPLTKGDP
FT                   VKRTGTTVRFWADPEIFETTHYDFDTIARRLQEMAFLNKGLIITLTDLREGQIDAAEDG
FT                   EALDTAEVARSEQEAQAQAPAVKRREYHYPGGLHDYVGHINRTKTAVHNSIVSFEGKGE
FT                   GHEVEIAMQWNSGYTESVYTFANTINTHEGGTHEEGFRAALTSTMNKYARDKKILKEKD
FT                   KNLTGDDVREGLAAVISVKLGEPQFEGQTKTKLGNTEIRSFVQKICNEELTHWFEANPS
FT                   EAKLIVTKAQQAYLAREAARSARETVRRKTATDIGGLPGKLADCRSKDPSKSEVYIVEG
FT                   DSAGGSAKSGRNSEFQAILPIRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHDEFDL
FT                   AKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLAAPPLYKLKWQRAEP
FT                   EYAYSDRERDALIEAGLSAGKRINKDDGVQRYKGLGEMNAKELWETTMDPDTRTLRLVT
FT                   MDDAAAADELFSILMGEDVPARRGFIARNARDVRFLDV"
     MSEKKNADKS SYGASSITIL EGLEAVRKRP GMYIGSTGER GLHHLVQEVV DNSVDEAMAG        60
     YATRVDVTLL ADGGVEVVDD GRGIPVAPHA SGPPTVEVVL TVLHAGGKFD SDSYAVSGGL       120
     HGVGISVVNA LSYKLEVEID VDGFHWSQSY DKAKPGPLTK GDPVKRTGTT VRFWADPEIF       180
     ETTHYDFDTI ARRLQEMAFL NKGLIITLTD LREGQIDAAE DGEALDTAEV ARSEQEAQAQ       240
     APAVKRREYH YPGGLHDYVG HINRTKTAVH NSIVSFEGKG EGHEVEIAMQ WNSGYTESVY       300
     TFANTINTHE GGTHEEGFRA ALTSTMNKYA RDKKILKEKD KNLTGDDVRE GLAAVISVKL       360
     GEPQFEGQTK TKLGNTEIRS FVQKICNEEL THWFEANPSE AKLIVTKAQQ AYLAREAARS       420
     ARETVRRKTA TDIGGLPGKL ADCRSKDPSK SEVYIVEGDS AGGSAKSGRN SEFQAILPIR       480
     GKIINVEKAR IDRVLKNTEV QSIITAFGTG IHDEFDLAKL RYHKIVLMAD ADVDGQHIST       540
     LLLTLLFRFM RPLVEHGHVY LAAPPLYKLK WQRAEPEYAY SDRERDALIE AGLSAGKRIN       600
     KDDGVQRYKG LGEMNAKELW ETTMDPDTRT LRLVTMDDAA AADELFSILM GEDVPARRGF       660
     IARNARDVRF LDV                                                          673
//

If you have problems or comments...

PBIL Back to PBIL home page