(data stored in ACNUC7421 zone)

EMBL: CP001958.PE108

CP001958.PE108       Location/Qualifiers
FT   CDS             88922..89521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96601"
FT                   /db_xref="GOA:D6Z9S4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S4"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0008"
FT                   /protein_id="ADG96601.1"
FT                   /translation="MSNPPEQEPPTTALPKVAAPARRPAERISPASDSVSAVTARLADA
FT                   RRSGADRSGSSRPAPDPAPSSAPKAAAVPSQQPSGPLRAQVQVRWIDPWTVLKVTAAVM
FT                   VVLFVAWMIGVAVLYALLEAIGVMGKINSGLGDFSTAAADQGGDIVTPGMVFGFSALVG
FT                   IVNIVLVTALATVGAFIFNLCVDLVGGVEITLADPE"
     MSNPPEQEPP TTALPKVAAP ARRPAERISP ASDSVSAVTA RLADARRSGA DRSGSSRPAP        60
     DPAPSSAPKA AAVPSQQPSG PLRAQVQVRW IDPWTVLKVT AAVMVVLFVA WMIGVAVLYA       120
     LLEAIGVMGK INSGLGDFST AAADQGGDIV TPGMVFGFSA LVGIVNIVLV TALATVGAFI       180
     FNLCVDLVGG VEITLADPE                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page