(data stored in ACNUC7421 zone)

EMBL: CP001958.PE109

CP001958.PE109       Location/Qualifiers
FT   CDS             89950..91038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_56140 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96602"
FT                   /db_xref="GOA:D6Z9S5"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S5"
FT                   /inference="similar to AA sequence:KEGG:ROP_56140"
FT                   /protein_id="ADG96602.1"
FT                   /translation="MARKHFFAGVERLKLTALPIVQCSVGAGLAWFVAKNIVGHASPFF
FT                   APVAAVISLGVSLGSRWRRAVELVCGVMLGIVIGDLLVRVTGHGWWQISFFVAAAMVLA
FT                   TFIDKGLIFPMQAASSALLVVLFPPTVGGASIAGPGRLVDAFVGGVIGILISALLPAHP
FT                   FLRAHQAAAAVLATGESVLRGVAEGLAARDADRIEEVLSLARSSQPQIDTLQNYLRAGD
FT                   EIVRISPLFWAYRDRVHEVSASADHIDRIIRDLRVLARRAWILVNSGGKTGAGLTRAIE
FT                   STADAVAQVRLLWLAKKPDQAQREEVLAALQECAARLDPTMLSGVALSAEVVFAQLEST
FT                   IFDLFQAAGFDSATALRALREA"
     MARKHFFAGV ERLKLTALPI VQCSVGAGLA WFVAKNIVGH ASPFFAPVAA VISLGVSLGS        60
     RWRRAVELVC GVMLGIVIGD LLVRVTGHGW WQISFFVAAA MVLATFIDKG LIFPMQAASS       120
     ALLVVLFPPT VGGASIAGPG RLVDAFVGGV IGILISALLP AHPFLRAHQA AAAVLATGES       180
     VLRGVAEGLA ARDADRIEEV LSLARSSQPQ IDTLQNYLRA GDEIVRISPL FWAYRDRVHE       240
     VSASADHIDR IIRDLRVLAR RAWILVNSGG KTGAGLTRAI ESTADAVAQV RLLWLAKKPD       300
     QAQREEVLAA LQECAARLDP TMLSGVALSA EVVFAQLEST IFDLFQAAGF DSATALRALR       360
     EA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page