(data stored in ACNUC7421 zone)

EMBL: CP001958.PE111

CP001958.PE111       Location/Qualifiers
FT   CDS             92288..93448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0113"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: rha:RHA1_ro04868 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96604"
FT                   /db_xref="GOA:D6ZA62"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA62"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADG96604.1"
FT                   /translation="MTTTFAAPALRIGPFELASPVVLAPMAGVTNLAFRTVCRELETRL
FT                   TGQARGLYVNEMVMARSLVNRNPKAMRMIEFGPEERPRSMQLYTVDPEAVGEAVRMIVA
FT                   EDLADHVDLNFGCPVPKVTRNGGGAALPYKRRLFARIIEAAVNGAQGAVPITVKFRVGI
FT                   DDEHHTYLDAGRIAQDSGAASVALHARTAAQLYSGTADWSAIARLKEHVTEIPVLGNGD
FT                   IFAAADAKRMMDQTGCDGVVVGRGCLGRPWLFAELAAALSGGAIPAPPPPNLGEVARIV
FT                   LRHAQLLVLHAGSHGVAEMRKHFAWYLRGFSVGSELRGKFSTVGSLAEIEDLLGQLPQE
FT                   EPFPEEAEGPRGRKGSPQKKVALPQGWLDDPQDWAVRLDDVEHSGG"
     MTTTFAAPAL RIGPFELASP VVLAPMAGVT NLAFRTVCRE LETRLTGQAR GLYVNEMVMA        60
     RSLVNRNPKA MRMIEFGPEE RPRSMQLYTV DPEAVGEAVR MIVAEDLADH VDLNFGCPVP       120
     KVTRNGGGAA LPYKRRLFAR IIEAAVNGAQ GAVPITVKFR VGIDDEHHTY LDAGRIAQDS       180
     GAASVALHAR TAAQLYSGTA DWSAIARLKE HVTEIPVLGN GDIFAAADAK RMMDQTGCDG       240
     VVVGRGCLGR PWLFAELAAA LSGGAIPAPP PPNLGEVARI VLRHAQLLVL HAGSHGVAEM       300
     RKHFAWYLRG FSVGSELRGK FSTVGSLAEI EDLLGQLPQE EPFPEEAEGP RGRKGSPQKK       360
     VALPQGWLDD PQDWAVRLDD VEHSGG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page