(data stored in ACNUC7421 zone)

EMBL: CP001958.PE117

CP001958.PE117       Location/Qualifiers
FT   CDS             99608..100825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96610"
FT                   /db_xref="GOA:D6ZA68"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA68"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05190"
FT                   /protein_id="ADG96610.1"
FT                   /translation="MTQPQPGKAQNLLPLALIAFGAALLAIAVLVPLYSEDELVKASLS
FT                   DRITLVSPAQSTGEDGPGLSQEFPAQVIDRCSVSSDAAKAAVLQAKATIRTYVTVEEPS
FT                   TDSTVTYQAGTSVLVSEVKSQGDGQPKTLVPTALQRSASGAPAPKTPWSDGQCDNGLLL
FT                   ATVDRVTVGRHNGLPTAKGLSEVQVEPEQQAHLLPNRSGQQYRFPFDTSSKGKYQYFDV
FT                   TTGTSFPVTYVENTEISDIKTLHFHVDVPETDLALVNMPVGYDEKEWTAPPGTTLTKPL
FT                   NWWNIPNSPGGQDQTMHRFYRNGIDLYVDPESGVIVRERQDLRQYFAEPFSAREAASPD
FT                   LRNFTLTILSGVFDYNQQTIEATVKQAKSYQDDIALYGRTIPIGSAVLGLVLLAGGGVI
FT                   YYRLTR"
     MTQPQPGKAQ NLLPLALIAF GAALLAIAVL VPLYSEDELV KASLSDRITL VSPAQSTGED        60
     GPGLSQEFPA QVIDRCSVSS DAAKAAVLQA KATIRTYVTV EEPSTDSTVT YQAGTSVLVS       120
     EVKSQGDGQP KTLVPTALQR SASGAPAPKT PWSDGQCDNG LLLATVDRVT VGRHNGLPTA       180
     KGLSEVQVEP EQQAHLLPNR SGQQYRFPFD TSSKGKYQYF DVTTGTSFPV TYVENTEISD       240
     IKTLHFHVDV PETDLALVNM PVGYDEKEWT APPGTTLTKP LNWWNIPNSP GGQDQTMHRF       300
     YRNGIDLYVD PESGVIVRER QDLRQYFAEP FSAREAASPD LRNFTLTILS GVFDYNQQTI       360
     EATVKQAKSY QDDIALYGRT IPIGSAVLGL VLLAGGGVIY YRLTR                       405
//

If you have problems or comments...

PBIL Back to PBIL home page