(data stored in ACNUC7421 zone)

EMBL: CP001958.PE118

CP001958.PE118       Location/Qualifiers
FT   CDS             100829..102562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_52380 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96611"
FT                   /db_xref="GOA:D6ZA69"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA69"
FT                   /inference="similar to AA sequence:KEGG:ROP_52380"
FT                   /protein_id="ADG96611.1"
FT                   /translation="MPLVWLWSLTLSLVALGPLLGGGHWLWADAVSVPRSFLVDQAFGL
FT                   ADAAPRATPQDAALAAVSNILDGGLVVKAITVLALFAAGTGAARLVREFLPESSWAVHI
FT                   VAATFAIDNLWVVERLLQGQWSLLVGYGALGHVAVVAARLRNTPSASGWAELGFWLAAG
FT                   GLVPTGALLVAVLAGLVLAAPGGARWWRRTAAFTGLAIVAASPWAAAGLFGLCGPELAD
FT                   GGAAGAHAFATRPDRAGWLALGGIWNAGSTPDSQRGAWGLAADLALVALVAAGAFLLRR
FT                   RLRQDRAFALLFALGLAAVALVGLSATGFAQSSLAEAMATTPALGVLRDGQKWAALAWP
FT                   AYALALSWIAMRAKQWACALVPVVLLLVPDALWGAGGRLAPVRYPNDWFEVRSLVAADP
FT                   SHGALLTVPVGITRQYDWAGRRTSIDPAPRLLPVPVAQSGDLVVAGAVVPGEGALARRA
FT                   AAHVRAGAGPERFAEDSIGWVLVERDQLSALPPAALAALARFELVRSDQHFDLYRNPLT
FT                   PWPVPAVPDAARRVVVAAHLAWAALLACGAAGALWRRRAPGARLGRIGGTCPDGFREKA
FT                   L"
     MPLVWLWSLT LSLVALGPLL GGGHWLWADA VSVPRSFLVD QAFGLADAAP RATPQDAALA        60
     AVSNILDGGL VVKAITVLAL FAAGTGAARL VREFLPESSW AVHIVAATFA IDNLWVVERL       120
     LQGQWSLLVG YGALGHVAVV AARLRNTPSA SGWAELGFWL AAGGLVPTGA LLVAVLAGLV       180
     LAAPGGARWW RRTAAFTGLA IVAASPWAAA GLFGLCGPEL ADGGAAGAHA FATRPDRAGW       240
     LALGGIWNAG STPDSQRGAW GLAADLALVA LVAAGAFLLR RRLRQDRAFA LLFALGLAAV       300
     ALVGLSATGF AQSSLAEAMA TTPALGVLRD GQKWAALAWP AYALALSWIA MRAKQWACAL       360
     VPVVLLLVPD ALWGAGGRLA PVRYPNDWFE VRSLVAADPS HGALLTVPVG ITRQYDWAGR       420
     RTSIDPAPRL LPVPVAQSGD LVVAGAVVPG EGALARRAAA HVRAGAGPER FAEDSIGWVL       480
     VERDQLSALP PAALAALARF ELVRSDQHFD LYRNPLTPWP VPAVPDAARR VVVAAHLAWA       540
     ALLACGAAGA LWRRRAPGAR LGRIGGTCPD GFREKAL                                577
//

If you have problems or comments...

PBIL Back to PBIL home page