(data stored in ACNUC7421 zone)

EMBL: CP001958.PE12

CP001958.PE12        Location/Qualifiers
FT   CDS             14726..15334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0012"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: saq:Sare_5095 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96505"
FT                   /db_xref="GOA:D6Z9H8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG96505.1"
FT                   /translation="MTSNLFEPQDDEGPGDKELLQAHVAGDKRAFATLFRRHYNRMWAV
FT                   ALRTCFNPEEAAEAIQEAMLSAHQAASSFRGDAAVSTWLHRIVVNACLDRARRQRSRPP
FT                   AVPLPEEEELEKTSLRQRPDNDTALSLAVRDALNALPYEHRVVLVAVDVEGYSVEEAAR
FT                   LLDIPQGTVKSRCARGRAKLAKQLGFLRKEGNQSGSANV"
     MTSNLFEPQD DEGPGDKELL QAHVAGDKRA FATLFRRHYN RMWAVALRTC FNPEEAAEAI        60
     QEAMLSAHQA ASSFRGDAAV STWLHRIVVN ACLDRARRQR SRPPAVPLPE EEELEKTSLR       120
     QRPDNDTALS LAVRDALNAL PYEHRVVLVA VDVEGYSVEE AARLLDIPQG TVKSRCARGR       180
     AKLAKQLGFL RKEGNQSGSA NV                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page