(data stored in ACNUC7421 zone)

EMBL: CP001958.PE121

CP001958.PE121       Location/Qualifiers
FT   CDS             108076..108924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0124"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: hch:HCH_04117 carbonic anhydrase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96614"
FT                   /db_xref="GOA:D6ZA72"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA72"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG96614.1"
FT                   /translation="MREIIEGFLTFQQEIYPKRLELFKKLAAAQSPKALFISCSDSRVV
FT                   LELLTQQEPGDLFVIRNAGNIVPPYGPEPGGVTATVEYAVAVLQVTDIVVMGHSNCGAM
FT                   KAIAAGQPLDSLPAVSHWLRYSDAAKAVNQAREYGSDDEKLTALVHDNVVAQISNLKTH
FT                   PTVALALAEQPLSIGQLETVVGLDSPDGELPVPLRYPVAEVLKGWFAPVSSDAGAPDSV
FT                   VFVDSSARPKLLAHLAAGGRLVGFGLDLDGGRAAAAQGRRGRSRAVRPGGGFGLMLAPP
FT                   K"
     MREIIEGFLT FQQEIYPKRL ELFKKLAAAQ SPKALFISCS DSRVVLELLT QQEPGDLFVI        60
     RNAGNIVPPY GPEPGGVTAT VEYAVAVLQV TDIVVMGHSN CGAMKAIAAG QPLDSLPAVS       120
     HWLRYSDAAK AVNQAREYGS DDEKLTALVH DNVVAQISNL KTHPTVALAL AEQPLSIGQL       180
     ETVVGLDSPD GELPVPLRYP VAEVLKGWFA PVSSDAGAPD SVVFVDSSAR PKLLAHLAAG       240
     GRLVGFGLDL DGGRAAAAQG RRGRSRAVRP GGGFGLMLAP PK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page