(data stored in ACNUC7421 zone)

EMBL: CP001958.PE122

CP001958.PE122       Location/Qualifiers
FT   CDS             complement(108977..111112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_2960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96615.1"
FT                   /translation="MAGTSSKALAFLLAKPKLAASVAVAATAVAGTGVATYNSGPGDAL
FT                   WGLQKTVFSSHAQQVAVNDVASDLKNAQALLSKNPIGADDLGQARNYLNQAKQLIDDAS
FT                   NVPDANQRAGLQQLYLQLTQNLADSVPPPADLPAAPDASLDANAQGSVATQASAQLPTW
FT                   GYSTQAAASASAPQPPAQVAGADISNPPGEADPDWSDPTPAAATLNQQELGYYDPTWDT
FT                   FYGYNRDDWHRWGLDGYNPYGYDYTGYDRYGYDRAGYDRWGYDRRGYDRYGYNYAGWRY
FT                   DPISRMGWHRDGYNEWGQRQGHPDDPRNAGWRDKWYNRYQGYYENRWYYNDPVYQRHQW
FT                   DRDRWLRQNPSGADAQFNVYVETARLRPFLPVVNLNVSLGQFVDIQVPRQTRDFVRNGV
FT                   IATLAAADIVAHIAQEAVPIVRVRQQQEQFFDRRAAEANAKVALDIPVAGSLNAQFNAQ
FT                   ASGGLATRPDPGQPNPRPGQNGQASLSSSVEAAAAITTPPIFGAGANVQQLLQVQQSQQ
FT                   QQRQQRVSAEAKAQIQAEIAQEQKSRPTTPPKQPVAPAQGGQVGGQVNGQVGGQAGAGG
FT                   VNGQIGGQADGKAGGAGGVNGQIGGQAGGQVGPGGAGANGQADGRAGASPAPEPRQERP
FT                   QPQQGGQVGGQAGGQAGGQVGPGGAGANGQIGGQAGGKAGGPGGPAGGAGASGQAGGQA
FT                   GPGGPGGATIPAGPGGR"
     MAGTSSKALA FLLAKPKLAA SVAVAATAVA GTGVATYNSG PGDALWGLQK TVFSSHAQQV        60
     AVNDVASDLK NAQALLSKNP IGADDLGQAR NYLNQAKQLI DDASNVPDAN QRAGLQQLYL       120
     QLTQNLADSV PPPADLPAAP DASLDANAQG SVATQASAQL PTWGYSTQAA ASASAPQPPA       180
     QVAGADISNP PGEADPDWSD PTPAAATLNQ QELGYYDPTW DTFYGYNRDD WHRWGLDGYN       240
     PYGYDYTGYD RYGYDRAGYD RWGYDRRGYD RYGYNYAGWR YDPISRMGWH RDGYNEWGQR       300
     QGHPDDPRNA GWRDKWYNRY QGYYENRWYY NDPVYQRHQW DRDRWLRQNP SGADAQFNVY       360
     VETARLRPFL PVVNLNVSLG QFVDIQVPRQ TRDFVRNGVI ATLAAADIVA HIAQEAVPIV       420
     RVRQQQEQFF DRRAAEANAK VALDIPVAGS LNAQFNAQAS GGLATRPDPG QPNPRPGQNG       480
     QASLSSSVEA AAAITTPPIF GAGANVQQLL QVQQSQQQQR QQRVSAEAKA QIQAEIAQEQ       540
     KSRPTTPPKQ PVAPAQGGQV GGQVNGQVGG QAGAGGVNGQ IGGQADGKAG GAGGVNGQIG       600
     GQAGGQVGPG GAGANGQADG RAGASPAPEP RQERPQPQQG GQVGGQAGGQ AGGQVGPGGA       660
     GANGQIGGQA GGKAGGPGGP AGGAGASGQA GGQAGPGGPG GATIPAGPGG R                711
//

If you have problems or comments...

PBIL Back to PBIL home page