(data stored in ACNUC7421 zone)

EMBL: CP001958.PE123

CP001958.PE123       Location/Qualifiers
FT   CDS             111311..111961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0126"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: pfo:Pfl01_2731 carbonate dehydratase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96616"
FT                   /db_xref="GOA:D6ZA74"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA74"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG96616.1"
FT                   /translation="MREIIEGFLTFQQEIYPKRLELFKKLAAAQSPKALFISCSDSRVV
FT                   LELLTQQEPGDLFVIRNAGNIVPPYGPEPGGVTATVEYAVAVLQVTDIVVMGHSNCGAM
FT                   KAIAAGQPLDSLPAVSHWLRYSDAAKAVNQAREYGSDDEKLTALVHDNVVAQISNLKTH
FT                   PTVALALEQGRLDLHGWVYDIEPGVIDAYDGTSRTFVPLSDNTKVSALATKQG"
     MREIIEGFLT FQQEIYPKRL ELFKKLAAAQ SPKALFISCS DSRVVLELLT QQEPGDLFVI        60
     RNAGNIVPPY GPEPGGVTAT VEYAVAVLQV TDIVVMGHSN CGAMKAIAAG QPLDSLPAVS       120
     HWLRYSDAAK AVNQAREYGS DDEKLTALVH DNVVAQISNL KTHPTVALAL EQGRLDLHGW       180
     VYDIEPGVID AYDGTSRTFV PLSDNTKVSA LATKQG                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page