(data stored in ACNUC7421 zone)

EMBL: CP001958.PE127

CP001958.PE127       Location/Qualifiers
FT   CDS             115729..117567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0131"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: rha:RHA1_ro05228 flavin
FT                   binding monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96620"
FT                   /db_xref="InterPro:IPR032371"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA78"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADG96620.1"
FT                   /translation="MTVSAQTGETQEQASGTAALLDVLVVGAGFSGICAGVKLQEAGVY
FT                   DFLIVEKAEDFGGTWWHNTYPGCAVDVTSPMYSFSFAQKSDWSNLFAPQPELLAYARQV
FT                   AKDFNLRPRTRFGVAVEQLVFDESADRWDVSLSDGSVYRARVVIGGFGGLHVPKIPEFA
FT                   GLSTFQGPVFHSAQWRHDVDLQGKKVVVIGTGASAVQFVPEVAKEAERLTVFMRSPHWV
FT                   LPRLDYSIKPWQHAVLKHVPGARRLLRAIAYFLYEGFVFNLFFPKVFARFFEAASKAHM
FT                   RRQIADPALRQLLTPDWRFGCKRVVMSSTYYPALQRPNVTLEHSGVAEFTEHGVRSADG
FT                   VLHEADVVILGTGFETTEGVLHLPIIGRGGTSLADAWHTDGPEQFLGLSTHGFPNLFTL
FT                   VGLNTTGGNQSVIFAIEAQMHYINQAIRWIFGSRSGVTRVELRESVQRRYNRDVQKKLK
FT                   KSVWLTGGCKSWYLDSEGRNAIAWPGFSFGLWCKTRFAKASDWELSGVQSRQIAEGYTG
FT                   PAEIVLVGESIPVEAEVRGHIDPLDGARPWYGRVVGGPSLGVLAASGDTTATLQIPGRE
FT                   AASVRLAGQDARGGFRVVGVGAPPFALGPAALERSG"
     MTVSAQTGET QEQASGTAAL LDVLVVGAGF SGICAGVKLQ EAGVYDFLIV EKAEDFGGTW        60
     WHNTYPGCAV DVTSPMYSFS FAQKSDWSNL FAPQPELLAY ARQVAKDFNL RPRTRFGVAV       120
     EQLVFDESAD RWDVSLSDGS VYRARVVIGG FGGLHVPKIP EFAGLSTFQG PVFHSAQWRH       180
     DVDLQGKKVV VIGTGASAVQ FVPEVAKEAE RLTVFMRSPH WVLPRLDYSI KPWQHAVLKH       240
     VPGARRLLRA IAYFLYEGFV FNLFFPKVFA RFFEAASKAH MRRQIADPAL RQLLTPDWRF       300
     GCKRVVMSST YYPALQRPNV TLEHSGVAEF TEHGVRSADG VLHEADVVIL GTGFETTEGV       360
     LHLPIIGRGG TSLADAWHTD GPEQFLGLST HGFPNLFTLV GLNTTGGNQS VIFAIEAQMH       420
     YINQAIRWIF GSRSGVTRVE LRESVQRRYN RDVQKKLKKS VWLTGGCKSW YLDSEGRNAI       480
     AWPGFSFGLW CKTRFAKASD WELSGVQSRQ IAEGYTGPAE IVLVGESIPV EAEVRGHIDP       540
     LDGARPWYGR VVGGPSLGVL AASGDTTATL QIPGREAASV RLAGQDARGG FRVVGVGAPP       600
     FALGPAALER SG                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page