(data stored in ACNUC7421 zone)

EMBL: CP001958.PE130

CP001958.PE130       Location/Qualifiers
FT   CDS             complement(121086..122093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0134"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: rha:RHA1_ro02194 amino acid ABC transporter
FT                   ATP-binding protein; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96623"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA81"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG96623.1"
FT                   /translation="MSAAALLRALAASLVSAVLAGCSAQGAAVIAQPSVSLPPLLPAGA
FT                   ALLDSAALSESEEGQCAPPLPLRPYSGNHDPIHGGRLDRILQRGKLVVGLDQGTYPFSY
FT                   RDSATGQMKGFDVAMAREIAQGMLGDPNRVDYRIISSAGRTTALENDSVDIVIKTMSIN
FT                   CKRMKEITFSEPYFETDQRVMAATNANATTLADRKILGESTVCAARGSTAVGHFHHLFP
FT                   TAKILGTTTWADCLVAIQQGSVDAISSDESILYGFYDQDPNLYFLSALQLGREVYGVGM
FT                   HKGEAELERVVNKIIEEIKADGTWTNLCRDNLKFSPCNRPPATPEYAPEEPSTP"
     MSAAALLRAL AASLVSAVLA GCSAQGAAVI AQPSVSLPPL LPAGAALLDS AALSESEEGQ        60
     CAPPLPLRPY SGNHDPIHGG RLDRILQRGK LVVGLDQGTY PFSYRDSATG QMKGFDVAMA       120
     REIAQGMLGD PNRVDYRIIS SAGRTTALEN DSVDIVIKTM SINCKRMKEI TFSEPYFETD       180
     QRVMAATNAN ATTLADRKIL GESTVCAARG STAVGHFHHL FPTAKILGTT TWADCLVAIQ       240
     QGSVDAISSD ESILYGFYDQ DPNLYFLSAL QLGREVYGVG MHKGEAELER VVNKIIEEIK       300
     ADGTWTNLCR DNLKFSPCNR PPATPEYAPE EPSTP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page