(data stored in ACNUC7421 zone)

EMBL: CP001958.PE131

CP001958.PE131       Location/Qualifiers
FT   CDS             complement(122090..123427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96624"
FT                   /db_xref="GOA:D6ZA82"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA82"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02193"
FT                   /protein_id="ADG96624.1"
FT                   /translation="MRTISPLSVLKTDAASLRRGRRTTADEDTDFLELLWERAQTSPGK
FT                   LAATALGLILLIIIAGATVAQAVAERTQGLDTTLRRAEPLTNVTLTLYTELSIADAITG
FT                   AVFLSPGLESQEMRDRYDKAIAAASAATVQVAANTQSQQLETIAEELPVYTKLVESAKV
FT                   YNRAGKPVGAAYLSQASHLMQTVILPAAEHMHRDQIDALEAAQQQQTQLPWAPALLLTL
FT                   ALGSLVLAQLHLSKRSRRRFNPGLILASGCFALLLLWFLVASAFLVTLSGEGQRKGTDP
FT                   LRTLTAARIDVQQARTQETLQLLRRGDEDQLEQSYRSSMAAAHNQLDELDRAQGEPGAR
FT                   QTAASAAQAWEKTHEQLRKDLVAGMYGESVELAIGPSPDACAAQYRSLDKALTSDIEHS
FT                   RRTLRDSVASAREALTALAPATAVLSFLAAAFVVAGYWPRLNEYRA"
     MRTISPLSVL KTDAASLRRG RRTTADEDTD FLELLWERAQ TSPGKLAATA LGLILLIIIA        60
     GATVAQAVAE RTQGLDTTLR RAEPLTNVTL TLYTELSIAD AITGAVFLSP GLESQEMRDR       120
     YDKAIAAASA ATVQVAANTQ SQQLETIAEE LPVYTKLVES AKVYNRAGKP VGAAYLSQAS       180
     HLMQTVILPA AEHMHRDQID ALEAAQQQQT QLPWAPALLL TLALGSLVLA QLHLSKRSRR       240
     RFNPGLILAS GCFALLLLWF LVASAFLVTL SGEGQRKGTD PLRTLTAARI DVQQARTQET       300
     LQLLRRGDED QLEQSYRSSM AAAHNQLDEL DRAQGEPGAR QTAASAAQAW EKTHEQLRKD       360
     LVAGMYGESV ELAIGPSPDA CAAQYRSLDK ALTSDIEHSR RTLRDSVASA REALTALAPA       420
     TAVLSFLAAA FVVAGYWPRL NEYRA                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page