(data stored in ACNUC7421 zone)

EMBL: CP001958.PE132

CP001958.PE132       Location/Qualifiers
FT   CDS             123455..124921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0136"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; PepSY-
FT                   associated TM helix domain protein; KEGG: msm:MSMEG_6570
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96625"
FT                   /db_xref="GOA:D6ZA83"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA83"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ADG96625.1"
FT                   /translation="MGLLSRSSEILRSSFPQSSVTKPDAGNFPGLISDLCNMMETVLPE
FT                   PPEVCPPPPARDRRTAVLAFFRRLHFYVGVFVGPFLLVSALTGVLYTVAPSMTQALHRH
FT                   ELSVEAAAAGTLPLSQQVRSAQQTYPGRVVLSVATGADARATTRVVMSGSGCPCTVFVD
FT                   PHTARVRGEAPGDGGQVFEAKWSDDLHRTLFLGEFGRNYAELSASWLWVLVVSGPVLWF
FT                   FGRRTRGGGPKAPRLSLRGSHATLGLALSLGLLFLSASGLSWSLHAGENIDALRTAVSG
FT                   ANPPLAKKLDPPVAPAAQGQPEWLARVDRVHAGARSAGLVDPIVITATDKPDSAWTASD
FT                   RERHYPMRNDRASVNPQTGAVVAVSRFQDWPMLAKITQWAIALHMGLLFGWANQLVLAV
FT                   LGIGLAVMIVLGYRMWWARRPRHDGGAWPAPAPQRGALGELPPSAAAALTGALLFAGWF
FT                   LPLFGASLAGFVLIDALLGWRARRRAREAQ"
     MGLLSRSSEI LRSSFPQSSV TKPDAGNFPG LISDLCNMME TVLPEPPEVC PPPPARDRRT        60
     AVLAFFRRLH FYVGVFVGPF LLVSALTGVL YTVAPSMTQA LHRHELSVEA AAAGTLPLSQ       120
     QVRSAQQTYP GRVVLSVATG ADARATTRVV MSGSGCPCTV FVDPHTARVR GEAPGDGGQV       180
     FEAKWSDDLH RTLFLGEFGR NYAELSASWL WVLVVSGPVL WFFGRRTRGG GPKAPRLSLR       240
     GSHATLGLAL SLGLLFLSAS GLSWSLHAGE NIDALRTAVS GANPPLAKKL DPPVAPAAQG       300
     QPEWLARVDR VHAGARSAGL VDPIVITATD KPDSAWTASD RERHYPMRND RASVNPQTGA       360
     VVAVSRFQDW PMLAKITQWA IALHMGLLFG WANQLVLAVL GIGLAVMIVL GYRMWWARRP       420
     RHDGGAWPAP APQRGALGEL PPSAAAALTG ALLFAGWFLP LFGASLAGFV LIDALLGWRA       480
     RRRAREAQ                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page