(data stored in ACNUC7421 zone)

EMBL: CP001958.PE133

CP001958.PE133       Location/Qualifiers
FT   CDS             124918..125598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0137"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ami:Amir_2588 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96626"
FT                   /db_xref="GOA:D6ZA84"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA84"
FT                   /inference="similar to AA sequence:KEGG:Amir_2588"
FT                   /protein_id="ADG96626.1"
FT                   /translation="MIADPWLRLALAALFGFSAGYCAWRLLRAGAFRPRLWRGCVGHVF
FT                   HLLMCLSMLAMIWPTTPAVPYSAQTAVFAVATLWFAALALGRSSQRAGRTGFACASGRG
FT                   AAWYHTTMMAAMLWMAAVMSGQLLGGAPPASAAPRPGGMAGMDMPGMSMQAEADGGARH
FT                   TAPMWMSAVDVLLGFMFLAAALWWVRGYFELRRSRGRSVPAEAEMLCEVAMALGMGAML
FT                   FAMV"
     MIADPWLRLA LAALFGFSAG YCAWRLLRAG AFRPRLWRGC VGHVFHLLMC LSMLAMIWPT        60
     TPAVPYSAQT AVFAVATLWF AALALGRSSQ RAGRTGFACA SGRGAAWYHT TMMAAMLWMA       120
     AVMSGQLLGG APPASAAPRP GGMAGMDMPG MSMQAEADGG ARHTAPMWMS AVDVLLGFMF       180
     LAAALWWVRG YFELRRSRGR SVPAEAEMLC EVAMALGMGA MLFAMV                      226
//

If you have problems or comments...

PBIL Back to PBIL home page