(data stored in ACNUC7421 zone)

EMBL: CP001958.PE139

CP001958.PE139       Location/Qualifiers
FT   CDS             complement(131658..132494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0143"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: mva:Mvan_1441 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96632"
FT                   /db_xref="GOA:D6ZA90"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA90"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADG96632.1"
FT                   /translation="MEHSRIPRKSTALAAALFCGAGLAVLAPHAAQAHADACPDVEVAF
FT                   ARGTNEPPGLGYMGEYFVDGLRERLPGKAIDAYAVDYPAVLSPESLGDGGNDLSQHVQN
FT                   VARSCPSTKIVLGGFSQGAGVVDLVTVSPLPTQSINLPILGEVSLADTGFDQPLPTNVF
FT                   PHIAAVAVFGNPVKHVYDGVLPMPDGLRSRTDDECADGDPVCHLPGPDDLSNFHNHDSY
FT                   IDRGLTDKAADFVVQHLGLRPNPPKTPTTSSSPDDDAFRPIQTPPPSDDDEEDGDN"
     MEHSRIPRKS TALAAALFCG AGLAVLAPHA AQAHADACPD VEVAFARGTN EPPGLGYMGE        60
     YFVDGLRERL PGKAIDAYAV DYPAVLSPES LGDGGNDLSQ HVQNVARSCP STKIVLGGFS       120
     QGAGVVDLVT VSPLPTQSIN LPILGEVSLA DTGFDQPLPT NVFPHIAAVA VFGNPVKHVY       180
     DGVLPMPDGL RSRTDDECAD GDPVCHLPGP DDLSNFHNHD SYIDRGLTDK AADFVVQHLG       240
     LRPNPPKTPT TSSSPDDDAF RPIQTPPPSD DDEEDGDN                               278
//

If you have problems or comments...

PBIL Back to PBIL home page