(data stored in ACNUC7421 zone)

EMBL: CP001958.PE140

CP001958.PE140       Location/Qualifiers
FT   CDS             complement(132593..133435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0144"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: mab:MAB_3766 cutinase cut3
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96633"
FT                   /db_xref="GOA:D6ZA91"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA91"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADG96633.1"
FT                   /translation="MMISSRVRGVLSGLLPLLSLSAASLPAVATMAPNAAAAPAGCADY
FT                   DISFARGTGEPAGVGVVGNAFANALKAKEPGKTFNVHGVDYAADYDFVALDLHSLAAGA
FT                   DNLSAHLQDVASRCPDTQFVLGGYSQGAALVDAVISFGVPLLGFSNPLPGDVANRIVGV
FT                   ALFGDATHRVFNGLQPVFITPDLAAKTTNICADGDPICENVEGGLDTQSADFNANHTSY
FT                   VSRGLTAQGAAFVADQINGQPAQAAPAPQPPAENDAQTAPDEDTTAAPEEEGSDADGE"
     MMISSRVRGV LSGLLPLLSL SAASLPAVAT MAPNAAAAPA GCADYDISFA RGTGEPAGVG        60
     VVGNAFANAL KAKEPGKTFN VHGVDYAADY DFVALDLHSL AAGADNLSAH LQDVASRCPD       120
     TQFVLGGYSQ GAALVDAVIS FGVPLLGFSN PLPGDVANRI VGVALFGDAT HRVFNGLQPV       180
     FITPDLAAKT TNICADGDPI CENVEGGLDT QSADFNANHT SYVSRGLTAQ GAAFVADQIN       240
     GQPAQAAPAP QPPAENDAQT APDEDTTAAP EEEGSDADGE                             280
//

If you have problems or comments...

PBIL Back to PBIL home page