(data stored in ACNUC7421 zone)

EMBL: CP001958.PE141

CP001958.PE141       Location/Qualifiers
FT   CDS             complement(133559..134989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0145"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; KEGG: rop:ROP_48780
FT                   adenylosuccinate lyase; PFAM: Adenylosuccinate lyase-like;
FT                   fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96634"
FT                   /db_xref="GOA:D6ZA92"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA92"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADG96634.1"
FT                   /translation="MSTPQTPDVLAARYATKELVALWSPRARVVLERDLWIAVLKAQIE
FT                   LGVPGGDAASVADYERVKEQVDLDSIAARERVTRHDVKARIDEFNALAGHELVHRGMTS
FT                   RDATENVEQSVIRASLAHVRDHAVAALARLAERAAQYAPTMLVARSHNVPAQATTLGKR
FT                   FATCAQELLIAVRRVDELIERYPLRGIQGPVGTAQDMLDLLGGDRDKFARLQRSVAEHV
FT                   GFTQALVSVGQIYPRSLDHDVVSALVQLAAAPSSFAHTLRLMAGQELATEGFQPGQVGS
FT                   SAMPHKTNPRTSERINGLAVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPDAFYAI
FT                   DGLFEGFLTVLGEFHAFEPVIEREVARYLPFLGTTRILMAAVRAGVGREAAHEAIKEHA
FT                   VALANDIRERGAEPDLLSRLAQDQRLGLTRAQLDEALADRDLFLGAADDQVRRVIDEVE
FT                   ALVAKHPEAAAYRPGSIL"
     MSTPQTPDVL AARYATKELV ALWSPRARVV LERDLWIAVL KAQIELGVPG GDAASVADYE        60
     RVKEQVDLDS IAARERVTRH DVKARIDEFN ALAGHELVHR GMTSRDATEN VEQSVIRASL       120
     AHVRDHAVAA LARLAERAAQ YAPTMLVARS HNVPAQATTL GKRFATCAQE LLIAVRRVDE       180
     LIERYPLRGI QGPVGTAQDM LDLLGGDRDK FARLQRSVAE HVGFTQALVS VGQIYPRSLD       240
     HDVVSALVQL AAAPSSFAHT LRLMAGQELA TEGFQPGQVG SSAMPHKTNP RTSERINGLA       300
     VVLRGYASMT AELAGAQWNE GDVFCSVVRR VALPDAFYAI DGLFEGFLTV LGEFHAFEPV       360
     IEREVARYLP FLGTTRILMA AVRAGVGREA AHEAIKEHAV ALANDIRERG AEPDLLSRLA       420
     QDQRLGLTRA QLDEALADRD LFLGAADDQV RRVIDEVEAL VAKHPEAAAY RPGSIL           476
//

If you have problems or comments...

PBIL Back to PBIL home page